PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010937354.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 405aa    MW: 45580.7 Da    PI: 7.2614
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010937354.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yLk+k+++++l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+
  XP_010937354.1  14 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIRQLDIYKYDPWDLPKLATTGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDRPIYSS 107
                     579***************************.89***************8888999***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  XP_010937354.1 108 eGTKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 141
                     56667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-5812172IPR003441NAC domain
PROSITE profilePS5100557.08214172IPR003441NAC domain
PfamPF023651.3E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MDERNDMDKG DEVMLPGFRF HPTDEELVGF YLKRKIQQRP LSIELIRQLD IYKYDPWDLP  60
KLATTGEKEW YFYCPRDRKY RNSTRPNRVT GAGFWKATGT DRPIYSSEGT KCIGLKKSLV  120
FYKGRAAKGI KTDWMMHEFR LPSLSDPSLP KRPLDKNIPA NDSWAICRIF KKTNSMAQRA  180
LSHSWVSPLP ETNDQDLFSV SHTAQRTQFA SENSSRTTEV GSAIQFGCNN SIQQQACTMG  240
YSPLDFTSYK PMDLIGCKPS QFLPVSGAEI PTSFMFSPAE VSMPSKCPVD VAAMLLNISP  300
TILGDVEKAS ESIGFGQPQQ FNGITVDLPL EMSSSLGSGE EEMSTKKTAN TCNVSNNQWG  360
AVKTISFPFS LPSNLSDEWK PNLEWDSPPC PSEMPKTYST YKCYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-531617519168NAC domain-containing protein 19
4dul_A5e-531617519168NAC domain-containing protein 19
1ut7_B5e-531617519168NO APICAL MERISTEM PROTEIN
1ut7_A5e-531617519168NO APICAL MERISTEM PROTEIN
1ut4_B5e-531617519168NO APICAL MERISTEM PROTEIN
1ut4_A5e-531617519168NO APICAL MERISTEM PROTEIN
3swp_D5e-531617522171NAC domain-containing protein 19
3swp_C5e-531617522171NAC domain-containing protein 19
3swp_B5e-531617522171NAC domain-containing protein 19
3swp_A5e-531617522171NAC domain-containing protein 19
3swm_D5e-531617522171NAC domain-containing protein 19
3swm_C5e-531617522171NAC domain-containing protein 19
3swm_B5e-531617522171NAC domain-containing protein 19
3swm_A5e-531617522171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937354.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-109FEZ_ARATH; Protein FEZ
TrEMBLM0T3L60.0M0T3L6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P02680_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-110NAC family protein